PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_029770
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family HD-ZIP
Protein Properties Length: 274aa    MW: 30791.6 Da    PI: 7.5055
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_029770genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.42.4e-1898152256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  DCAR_029770  98 RKKLRLSKEQAAMLEETFKEHNTLNPKQKLALAKELNLRPRQVEVWFQNRRARTK 152
                  788899***********************************************98 PP

2HD-ZIP_I/II128.52.7e-4198187191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlskeq+++LEe+F+e+++L+p++K +la+eL+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL+kev+eLr +l
  DCAR_029770  98 RKKLRLSKEQAAMLEETFKEHNTLNPKQKLALAKELNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCENLTDENKRLQKEVSELR-AL 187
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046183.3E-124078IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466893.17E-1893155IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-1793157IPR009057Homeodomain-like
PROSITE profilePS5007117.26594154IPR001356Homeobox domain
SMARTSM003894.0E-1596158IPR001356Homeobox domain
CDDcd000861.09E-1498155No hitNo description
PfamPF000467.4E-1698152IPR001356Homeobox domain
PROSITE patternPS000270129152IPR017970Homeobox, conserved site
PfamPF021831.1E-10154188IPR003106Leucine zipper, homeobox-associated
SMARTSM003403.7E-26154197IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MGERDDEFGL SLSLGSNHPH PPPHFPLPLR FLNPDLSGER RMRGIDVNMP AAEVEEELGA  60
SSPNSTVSSL SGKRSENEVE RDRDSSYEDE DGGDAAARKK LRLSKEQAAM LEETFKEHNT  120
LNPKQKLALA KELNLRPRQV EVWFQNRRAR TKLKQTEVDC EYLKRCCENL TDENKRLQKE  180
VSELRALKLS PQFYMNMNPP TTLTMCPQCE RVSSSSSTTS ASVSSALYPK TGMVNERNPN  240
NPVGPPQPHR PVPINPSWAK IFSQNQLEGH RPS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146154RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234233.11e-101HD-ZIP protein
SwissprotP466024e-83HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLQ424371e-101Q42437_SOLLC; HD-ZIP protein
STRINGSolyc01g090460.2.11e-101(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.17e-78homeobox-leucine zipper protein 3